PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID WALNUT_00008208-RA
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fagales; Juglandaceae; Juglans
Family NAC
Protein Properties Length: 235aa    MW: 26678.9 Da    PI: 8.074
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
WALNUT_00008208-RAgenomeJHUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM153.41e-47131391128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdke 91 
                         lppGfrF+Ptdeelv +yLk kv + +l+++ + +++++ +++PwdLp    + e+e+yfFs+++ ky++++r++r+t+sgyWkatg+dk+
  WALNUT_00008208-RA  13 LPPGFRFQPTDEELVFHYLKSKVFSCPLPASIIPDHIKVWEYDPWDLPGG--TLEQEMYFFSHKEAKYQNSNRTKRTTNSGYWKATGSDKK 101
                         79****************************6667777***********43..45789********************************** PP

                 NAM  92 vlsk.kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++s+ +++++g+kktLvfy+g+ ++g k+dW+mheyrl
  WALNUT_00008208-RA 102 IMSSkRDSVMGMKKTLVFYRGKPSQGFKSDWIMHEYRL 139
                         **98677789**************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019415.75E-535182IPR003441NAC domain
PROSITE profilePS5100552.32913182IPR003441NAC domain
PfamPF023651.0E-2614139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MDKLKFARNG SRLPPGFRFQ PTDEELVFHY LKSKVFSCPL PASIIPDHIK VWEYDPWDLP  60
GGTLEQEMYF FSHKEAKYQN SNRTKRTTNS GYWKATGSDK KIMSSKRDSV MGMKKTLVFY  120
RGKPSQGFKS DWIMHEYRLV DAGTTACILS HEEQLQYDNS ITQNPNNLDQ VENWVLCRIF  180
SKKGIGMEIN DAVINEATSD DKVENFGTTV SSSTTDHLGT QTTVSSSSSS SSRSQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-421318315169Stress-induced transcription factor NAC1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007211149.11e-79hypothetical protein PRUPE_ppa027024mg
RefseqXP_008239527.11e-79PREDICTED: NAC transcription factor 25
SwissprotQ9FY934e-64NAC83_ARATH; NAC domain-containing protein 83
TrEMBLM5WSR91e-79M5WSR9_PRUPE; Uncharacterized protein
STRINGPOPTR_0001s13380.16e-74(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF70434139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13180.16e-65NAC domain containing protein 83